Pay in 4 interest-free payments of $6.64 Learn more
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
161748-29-4 Appearance Solid Molecular Weight 3089.41 Formula C 140 H 214 N 36 O 43 Color White to off-white Sequence Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Shipping Room temperature in continental US
This novel manufacturing method enables rapid, cost-effective, and intuitive production of a soft robotic actuator
Bes F, Hofman W, Schuur J, Van Boxtel C
3 While more research is needed, these findings make metformin an increasingly interesting medication for various health applications
Recommended for sportsmen and everyone who performs high physical activity and wants to lose weight in a healthy way.
This means you should be careful about how much you take
US$ 25.36
US$ 29.15
US$ 22.73
US$ 28.18
US$ 24.60
